Database of Liver Modification Profile.dbLMP
Back Home
Total 1047 Records   FirstPage    1    2    3    4    5    6    7    8    9    10  NextPage  LastPage
Accession/Gi Experiment IPI Number Identified AcetylationPeptide Protein Function
38327627 through only single charged fragments search R.GMK*GLVYETSVLDPDEGIR.F citrate synthase , isoform b
196259796 through only single charged fragments search K.TVEWDWK*LLTYVMEEEGQTLPGR.V hypothetical protein LOC375484
38505213 through only single charged fragments search K.YKK*EKQQEEK*QQTTLTEWYSAQENSFK.P YTH domain containing 2
38505218 through only single charged fragments search R.IAIEK*IR.L putative acyl-CoA dehydrogenase
38569411 through only single charged fragments search K.GGQNSTAASTK*YDVFR.Q AP1 gamma subunit binding protein 1 isoform 2
38788333 through only single charged fragments search K.YLCECQFDDNLK*FK.N remodeling and spacing factor 1
38788445 through only single charged fragments search R.DLLTLK*NFTGEEIK.Y ornithine carbamoyltransferase
39540514 through only single charged fragments search K.MK*EEYDK*IQIADLMEEK.F pyrin and HIN domain family, member 1 alpha 1
39753961 through only single charged fragments search K.EQLSDMMVLDK*QKGLK.S IQ motif containing GTPase activating protein 3
40254982 through only single charged fragments search K.LEQLELEKQK*LQEEQENAPEFVK.V hypothetical protein LOC83641
40254986 through only single charged fragments search R.DEQQISAAVEK*AIK.K hydroxysteroid dehydrogenase like 2
40255133 through only single charged fragments search K.WK*DPLTQMPKWK*ESSHQGAAPR.R hypothetical protein LOC222256
40255149 through only single charged fragments search K.QWLFSK*LPEVK*STSER.F Rho guanine nucleotide exchange factor (GEF) 19
40316935 through only single charged fragments search R.K*LGNLAVPADEK.W alsin
40354205 through only single charged fragments search K.DGVDFGK*WR.A Aldolase B
112821690 through only single charged fragments search K.QLGADSK*LQLK.Q hypothetical protein LOC285513
38261962 through only single charged fragments search K.LEQIQSK*DSLDEK.N activating transcription factor 7 interacting protein
40385867 through only single charged fragments search R.KKKK*DGDGDGDGATGK*KKK.K methionine aminopeptidase 1D
40556361 through only single charged fragments search K.GQNMYPEGQVK*SQMK.C hypothetical protein LOC56964
40789249 through only single charged fragments search K.MPTGEIEIK*VK.T aspartyl-tRNA synthetase 2 (mitochondrial)
40805843 through only single charged fragments search R.IAVK*K*AQLR.S p300/CBP-associated factor
41019126 through only single charged fragments search K.LASEILMQNWDAAMEDLTRLK*ETIDNNSVSSPLQSLQQR.T Eukaryotic translation initiation factor 3 subunit 6
41149376 through only single charged fragments search K.WSESSVVK*WPYTK.V hypothetical protein XP_373451
41281466 through only single charged fragments search K.VDTTLSDSYNYSGTENLK*DK.K endosome-associated FYVE-domain protein
41281499 through only single charged fragments search K.ELLSLKNEYEGKLDGLIK*ETEENENK*IKK.L Rb1-inducible coiled coil protein 1
41281987 through only single charged fragments search R.AIQERAK*EAVTK.S nesprin 1 longest
41322908 through only single charged fragments search K.FK*EMELPAKEADK.N plectin 1 isoform 3
41872631 through only single charged fragments search K.GVDLVLNSLAEEK*LQASVR.C fatty acid synthase
42544130 through only single charged fragments search K.K*AVEQIRNILK.Q splicing factor 1 isoform 1
42544243 through only single charged fragments search K.GWLTISNIGIMK*GGSK.G dynamin 3
42560244 through only single charged fragments search R.SSVEK*ENQK*SK.G peptidyl-prolyl isomerase G (cyclophilin G)
42716289 through only single charged fragments search K.LAPNQTK*ELEEK*VMELHK.S erythrocyte membrane protein band 4.1
44680105 through only single charged fragments search K.CFTPK*GSSLK*IEER.A caldesmon 1 isoform 1
44681484 through only single charged fragments search R.LGSGYFSSNGK*LEEVK*TPK.N cell division cycle associated 2
44890052 through only single charged fragments search R.SK*ESVPEFPLSPPK.K stathmin 1
44917608 through only single charged fragments search R.VSYLLQEIYGIENK*NNQETK.P mahogunin, ring finger 1
45120115 through only single charged fragments search R.NPLCYGLSTCLGEGAVK*R.P hypothetical protein LOC56905
45238851 through only single charged fragments search R.YPRK*STPRRNK.L similar to RPL23AP7 protein
45333906 through only single charged fragments search R.SLK*YPYVAVMLK*VADHSGQVK.T COMM domain containing 6 isoform b
45439357 through only single charged fragments search R.LATK*TEPK.K elongin A2
45505147 through only single charged fragments search R.LELDK*YIQGLK*NNMNCEAR.G protein kinase Njmu-R1
45643119 through only single charged fragments search K.WDAWNALGSLPK*EAAR.Q peroxisomal D3,D2-enoyl-CoA isomerase isoform 1
46371197 through only single charged fragments search R.VGGKDLWSK*R.G heart alpha-kinase
46409304 through only single charged fragments search K.HK*SKK*KFK.N glutamate-rich 1
46409324 through only single charged fragments search K.WYTMLANEK*APVEGIGQPEK.V SPRY domain containing 4
46852147 through only single charged fragments search R.ELSNFYFSIIK*DR.L mitochondrial isoleucine tRNA synthetase
74735764 through only single charged fragments search R.ISHTLYDLDKIIELNGGQPPLTYK*R.F cryptochrome-1
47271356 through only single charged fragments search K.VIVGSLSVQDLQASQSACYWLK*GVR.Y solute carrier family 39 (zinc transporter)
47271493 through only single charged fragments search K.EQALKLIQILK*GQSLLQR.F hypothetical protein LOC348654
47575699 through only single charged fragments search R.FDPTQLTKGCK*VR.D KIAA1841 protein
47680169 through only single charged fragments search K.LEYDFPEK*FFPK.A 3-phosphoinositide dependent protein kinase-1
47717123 through only single charged fragments search K.EQEDIVVLK*AKK.K intersectin 1 isoform ITSN-l
48255898 through only single charged fragments search K.GK*GK*K*R.P SWI/SNF-related actin-dependent regulator of chromatin a2 isoform b
48255951 through only single charged fragments search K.SVLQGK*LTK.L plasma membrane calcium ATPase 2 isoform 1
48255968 through only single charged fragments search K.AHVDEFK*SVSK.F UDP-glucose pyrophosphorylase 2 isoform b
49258196 through only single charged fragments search R.LQELK*QRTK.E syntaxin 19
49456351 through only single charged fragments search IPI00027223 R.FK*DIFQEIYDK.Q Isocitrate dehydrogenase [NADP] cytoplasm
45580730 through only single charged fragments search R.VPDESLFLNSGGDSLK*SIRLLSEIEK.L 2-aminoadipic 6-semialdehyde dehydrogenase
49574537 through only single charged fragments search K.MTLSNPSELDELMSEEAYEK*YIK.S glycine cleavage system protein H
50080162 through only single charged fragments search R.ASESPSSLIFYRDGK*R.K FYVE, RhoGEF and PH domain containing 5
50083285 through only single charged fragments search K.DNQQK*K*IQK.V leucine-rich repeats and IQ motif containing 1
50345984 through only single charged fragments search R.GYLDK*LEPSK.I ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit
50345997 through only single charged fragments search R.EENTSNESTDVTK*GDSK*NAK*K.K E1A binding protein p300
50409939 through only single charged fragments search K.TEEK*LDLLTSK.C aftiphilin protein isoform a
50541965 through only single charged fragments search K.NLLK*YIQFK.T flavin containing monooxygenase 3 isoform 1
50659086 through only single charged fragments search R.DLK*GLYEDIR.K prenyl diphosphate synthase, subunit 1
50659095 through only single charged fragments search K.TK*KVTK*NEEPSEEEIDAPK.P DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
50659104 through only single charged fragments search K.LEEMGLNLRK*DQK*K.T Rab coupling protein isoform 3
50845386 through only single charged fragments search K.TDLEK*DIISDTSGDFR.K annexin A2 isoform 2
50845388 through only single charged fragments search K.TDLEK*DIISDTSGDFRK.L annexin A2 isoform 1
8051631 through only single charged fragments search K.IK*LK*SSELQAIK.T RNA-binding protein Raly
51467633 through only single charged fragments search R.LSMSLMEQLLK*TLR.Y nucleoporin 188kDa
51472437 through only single charged fragments search K.SPGIPAGAK*TKK.K similar to Golgin subfamily A member 6
91208418 through only single charged fragments search K.DSRFK*AIEK.M Transcription elongation regulator 1
51474256 through only single charged fragments search R.EEHKK*KNPK*VPINFAEFSK.K similar to high-mobility group box 3
51474786 through only single charged fragments search K.PYNNKECGK*VFSHHAYLAQHRK*IHTGEK.P similar to zinc finger protein 528
51475251 through only single charged fragments search K.FDDLTAEKEAVSSK*CVDLAK.D hypothetical protein
51477359 through only single charged fragments search K.QLLPK*TFGQSNVSIAQQVVIGMPQR.P similar to Transcription factor Dp-1
51477505 through only single charged fragments search K*IAK*QTNGYK.S PREDICTED: similar to Histone H3.3
51479141 through only single charged fragments search K.FEDPK*FEVIEKPQA ATP synthase, H+ transporting, F0 complex, subunit F6 isoform b
51479152 through only single charged fragments search K.NLIPDFLNEIPQMTIEDLNEAFPETKLDK*K.K ATP synthase, H+ transporting, mitochondrial F0 complex,subunit d
51592100 through only single charged fragments search R.DMLQAEKAEVAEALTK*AEAGR.V ciliary rootlet coiled-coil, rootletin
51827892 through only single charged fragments search K.QEEIDNYKKDLK*DLK*EK.V RAB6-interacting protein 2 isoform alpha
51972214 through only single charged fragments search K.K*GPSVQKR.K lin-28 homolog B
52138580 through only single charged fragments search K.FDPLVILK*TLSSYPIK.S xenobiotic/medium-chain fatty acid:CoA ligase
52426735 through only single charged fragments search R.EAQKTENQTIK*R.G ankyrin 2 isoform 1
47077105 through only single charged fragments search IPI00847755 K.DNRHVYEGKDGAIEDIITALK*K.N unnamed protein product
52486999 through only single charged fragments search K.EK*ERCTALQDKLLEEEK.K THO complex 2
52627166 through only single charged fragments search R.DK*VILLFSK*GTG.- olfactory receptor, family 52, subfamily H
52630322 through only single charged fragments search K.AGSMSK*QELDDILK.F chromodomain helicase DNA binding protein 3
53759107 through only single charged fragments search R.NDLMEYAK*QHGIPIPVTPK.N argininosuccinate synthetase 1
53832003 through only single charged fragments search K.DVAK*PVIELYK.S adenylate kinase 3-like 1 isoform 5
54112380 through only single charged fragments search K.MNRDNK*EGQEPAK*RRSECEEAPR.R F-box and leucine-rich repeat protein 10 isoform b
54112401 through only single charged fragments search K.HK*LNPEYFQTRQEK.L calmodulin-binding transcription activator 1
54291708 through only single charged fragments search K.PYK*CKECGK*AFQLHIQLTRHQK.F zinc finger protein 780B
54606888 through only single charged fragments search K.DCPQFVPASEPNFLLGVSK*EVKNR.A hypothetical protein LOC23251
54607053 through only single charged fragments search R.EILSELGK*CVAGK.D GCN1 general control of amino-acid synthesis 1
54696884 through only single charged fragments search IPI00013894 K.DFDTALK*HYDK.A stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)
54792146 through only single charged fragments search K.FLQLFGTK*GVK.R tripartite motif-containing 47
55418564 through only single charged fragments search IPI00293845 K.KNEPLGK*LTSLFK.L RIF1 275 kDa protein